Interleukin-8 (IL-8) is a chemokine produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles, the Weibel-Palade bodies. When first encountering an antigen, the primary cells to encounter it are the macrophages who phagocytose the particle. Upon processing, they release chemokines to signal other immune cells to come into the site of inflammation. IL-8 is one such chemokine. It serves as a chemical signal that attracts neutrophils at the site of inflammation, and therefore is also known as Neutrophil Chemotactic Factor.

Expression System Escherichia coli

Sequence

MSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEN WVQRVVEKFLKRAENS with polyhistidine tag at the C-terminus.

Species Human

Tag polyhistidine tag at the C-terminus

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Activity

Measure by its ability to chemoattract PBMC.

The ED50 for this effect is <2 ng/mL.

Purity  >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution

Unopened ampoules can be stored at -20°C or -80°C. Need not spin the ampoule. Open the cap carefully, then dissolve the lyophilized protein with sterile water for a 100 μg/mL concentration or according to the product’s Certificate of Analysis (CoA). Rinse the inner side of the ampoule gently and stand for at least 20 minutes at room temperature. (Important Note: Do Not Vortex!) Use the reconstituted solution immediately or store it by distributing it to aliquots and store at -20 °C. (Avoid repeated freeze-thaw cycles) We recommend diluting the solution to working concentration by using buffers or medium containing a carrier*. (Do not dilute the working solution with water, which may cause protein degradation.) *Carriers: 0.1% BSA or 5% HSA or 10% FBS.

Storage

Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

Note

Please use within one month after protein reconstitution.

SDS-PAGE analysis of recombinant human IL-8

Related Ordering Information

Caution

➢ During operation, always wear a lab coat, disposable gloves, and protective equipment.

➢ Research Use Only. Not intended for any animal or human therapeutic or diagnostic uses.