Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation of monocyte/ macrophage migration, neurons, cancer cells, kidney epithelial cells). VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF is also a that increases microvascular permeability and was originally referred to as vascular permeability factor. Elevated levels of this protein are linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy.

 

Expression System      Escherichia coli

Sequence

MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPL MRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK KDRARQENCDKPRR with polyhistidine tag at the C-terminus

Species      Human

Tag              polyhistidine tag at the C-terminus

Endotoxin Level <0.1 EU per 1 μg of the protein by the LAL method.

Activity

Measured by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is <2.5 ng/mL.

Purity    >95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution

➢ Keep ampoules at -20°C or -80°C for storage. ➢ No needs to spin the ampoule before opening. Remove the cap carefully.

➢ Dissolve the lyophilized protein by adding sterile ddH2O along the inner side of the ampoule to avoid generating bubbles. Make protein concentration to be at 100 μg/mL or consult the product’s Certificate of

Analysis (CoA). (Note: No needs to add carriers* to the initial reconstitution solution). Wear gloves when manipulating the sample to prevent contamination from proteases that may degrade the reconstituted

protein.

➢ Leave the reconstituted protein solution at room temperature for at least 20 minutes.

➢ Pipet the solution gently. The solution should be clear if proteins are fully dissolved. (Important Note: Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.)

➢ Use the reconstituted solution immediately, or make aliquots and store at -20 °C. (Important Note: Avoid repeated freeze-thaw cycles)

➢ We recommend diluting the initial reconstitution solution to working concentration with buffers or medium containing carriers*. ( Important Note: Do not use water for dilution, which may cause protein degradation.) *Carriers: 0.1% BSA, 5% HSA or 10% FBS

Storage

Lyophilized protein should be stored at -20°C. This product is stable for one year upon receipt, when handled and stored as instructed. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. Avoid repeated freeze/thaw cycles.

 

Note

Please use within one month after protein reconstitution

SDS-PAGE analysis of recombinant human VEFG 121

Related Ordering Information

Cat. No.	Description	Size
CC103-0500	DMEM, High Glucose	500 ml
CC109-0500	RPMI 1640	500 ml
CC113-0500	DMEM/F-12	500 ml
PC203-0600	60mm Tissue Culture Dish, with Gripping Ring	600 ea
PC273-0100	75T Flask, Plug Seal Cap	100 ea

Caution

➢ During operation, always wear a lab coat, disposable gloves, and protective equipment.

➢ Research Use Only. Not intended for any animal or human therapeutic or diagnostic uses.